UspF, Recombinant, E. coli, aa1-144, His-SUMO-Tag (Universal Stress Protein F)

Product Overview

• Article Name: UspF, Recombinant, E. coli, aa1-144, His-SUMO-Tag (Universal Stress Protein F)
• Biozol Catalog Number: USB-375798
• Supplier Catalog Number: 375798
• Alternative Catalog Number: USB-375798-20, USB-375798-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-144 from E. coli Universal Stress Protein F, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32kD Amino Acid Sequence: MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 32
• UniProt: P37903
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.