VACWR034, Recombinant, Vaccinia Virus, aa1-88, His-Tag (Protein K3)

Catalog Number: USB-375803
Article Name: VACWR034, Recombinant, Vaccinia Virus, aa1-88, His-Tag (Protein K3)
Biozol Catalog Number: USB-375803
Supplier Catalog Number: 375803
Alternative Catalog Number: USB-375803-20, USB-375803-100
Manufacturer: US Biological
Category: Molekularbiologie
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Source: Recombinant protein corresponding to aa1-88 from vaccinia virus Protein K3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.6kD Amino Acid Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.6
UniProt: P18378
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.