VSNL1, Recombinant, Human, aa1-191, GST-Tag (Visinin-like Protein 1)

Catalog Number: USB-375847
Article Name: VSNL1, Recombinant, Human, aa1-191, GST-Tag (Visinin-like Protein 1)
Biozol Catalog Number: USB-375847
Supplier Catalog Number: 375847
Alternative Catalog Number: USB-375847-20,USB-375847-100,USB-375847-1
Manufacturer: US Biological
Category: Molekularbiologie
Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner. Source: Recombinant protein corresponding to aa1-191 from human VSNL1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.0kD Amino Acid Sequence: GKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 49
UniProt: P62760
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.