VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)

Catalog Number: USB-375848
Article Name: VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)
Biozol Catalog Number: USB-375848
Supplier Catalog Number: 375848
Alternative Catalog Number: USB-375848-20,USB-375848-100,USB-375848-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa25-204 from human VSTM2L, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD Amino Acid Sequence: TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36
UniProt: Q96N03
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.