WDR1, Recombinant, Human, aa189-461, GST-Tag (WD Repeat-containing Protein 1)

Product Overview

• Article Name: WDR1, Recombinant, Human, aa189-461, GST-Tag (WD Repeat-containing Protein 1)
• Biozol Catalog Number: USB-375856
• Supplier Catalog Number: 375856
• Alternative Catalog Number: USB-375856-20,USB-375856-100,USB-375856-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Induces disassbly of actin filaments in conjunction with ADF/cofilin family proteins. Source: Recombinant protein corresponding to aa189-461 from human WDR1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.4kD Amino Acid Sequence: SRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 56.4
• UniProt: O75083
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.