XCL1, Recombinant, Human, aa22-114, His-Tag (Lymphotactin Protein)

Catalog Number: USB-375878
Article Name: XCL1, Recombinant, Human, aa22-114, His-Tag (Lymphotactin Protein)
Biozol Catalog Number: USB-375878
Supplier Catalog Number: 375878
Alternative Catalog Number: USB-375878-20,USB-375878-100,USB-375878-1
Manufacturer: US Biological
Category: Molekularbiologie
Chemotactic activity for lymphocytes but not for monocytes or neutrophils. Source: Recombinant protein corresponding to aa22-114 from human Lymphotactin Protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD Amino Acid Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.3
UniProt: P47992
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.