YciM, Recombinant, E. coli, aa17-389, His-SUMO-Tag (Uncharacterized Protein YciM)

Product Overview

• Article Name: YciM, Recombinant, E. coli, aa17-389, His-SUMO-Tag (Uncharacterized Protein YciM)
• Biozol Catalog Number: USB-375889
• Supplier Catalog Number: 375889
• Alternative Catalog Number: USB-375889-20,USB-375889-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Modulates cellular lipopolysaccharide (LPS) levels by regulating LpxC, which is involved in lipid A biosynthesis. May act by modulating the proteolytic activity of FtsH towards LpxC. May also coordinate assembly of proteins involved in LPS synthesis at the plasma membrane. Source: Recombinant protein corresponding to aa17-389 from E. coli YciM, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~58.8kD Amino Acid Sequence: WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 58.8
• UniProt: A0A0E1LWJ7
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.