ZNF160, Recombinant, Human, aa1-147, His-Tag (Zinc Finger Protein 160)

Catalog Number: USB-375911
Article Name: ZNF160, Recombinant, Human, aa1-147, His-Tag (Zinc Finger Protein 160)
Biozol Catalog Number: USB-375911
Supplier Catalog Number: 375911
Alternative Catalog Number: USB-375911-20,USB-375911-100
Manufacturer: US Biological
Category: Molekularbiologie
May be involved in transcriptional regulation. Source: Recombinant protein corresponding to aa1-147 from human ZNF160, fused to His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~22.1kD Amino Acid Sequence: MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.1
UniProt: Q9HCG1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.