ZNF91, Recombinant, Human, aa1-208, GST-Tag (Zinc Finger Protein 91)

Catalog Number: USB-375922
Article Name: ZNF91, Recombinant, Human, aa1-208, GST-Tag (Zinc Finger Protein 91)
Biozol Catalog Number: USB-375922
Supplier Catalog Number: 375922
Alternative Catalog Number: USB-375922-10,USB-375922-50,USB-375922-100,USB-375922-200
Manufacturer: US Biological
Category: Molekularbiologie
Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell membrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Partial recombinant protein corresponding to aa1-208 from human ZNF91, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~49.7kD Amino Acid Sequence: MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQIL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 49.7
UniProt: Q9BSJ8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.