IFNGR1 (Interferon Gamma Receptor 1, IFN-Gamma Receptor 1, IFN-Gamma-R1, CDw119, CD119), Rabbit

Catalog Number: USB-397443
Article Name: IFNGR1 (Interferon Gamma Receptor 1, IFN-Gamma Receptor 1, IFN-Gamma-R1, CDw119, CD119), Rabbit
Biozol Catalog Number: USB-397443
Supplier Catalog Number: 397443
Alternative Catalog Number: USB-397443-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: FC, IHC, WB
Immunogen: Synthetic peptide corresponding to aa443-484, a sequence QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED of human IFNGR1.
Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. Applications: Suitable for use in Flow Cytometry, Western Blot, Immunohistochemistry, Immunocytochemistry. Other applications not tested. Recommended Dilution: Flow Cytometry: 1-3ug/1x10e6 cells Western Blot: 0.1-0.5ug/ml Immunohistochemistry (frozen): 0.5-1ug/ml Immunocytochemistry: 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P15260
Purity: Purified by immunoaffinity chromatography.
Form: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.