INPP5D (Phosphatidylinositol 3,4,5-Trisphosphate 5-Phosphatase 1, Inositol Polyphosphate-5-Phosphatase of 145kD, SIP-145, SH2 Domain-Containing Inositol 5-Phosphatase 1, SH2 Domain-Containing Inositol Phosphatase 1, SHIP-1, p150Sh

Catalog Number: USB-397457
Article Name: INPP5D (Phosphatidylinositol 3,4,5-Trisphosphate 5-Phosphatase 1, Inositol Polyphosphate-5-Phosphatase of 145kD, SIP-145, SH2 Domain-Containing Inositol 5-Phosphatase 1, SH2 Domain-Containing Inositol Phosphatase 1, SHIP-1, p150Sh
Biozol Catalog Number: USB-397457
Supplier Catalog Number: 397457
Alternative Catalog Number: USB-397457-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: Synthetic peptide corresponding to a sequence NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ of human LGALS3BP.
Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 is an enzyme that in humans is encoded by the INPP5D gene. This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5 phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: Q92835
Purity: Purified by immunoaffinity chromatography.
Form: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.