Acetylcholine Receptor Subunit Alpha, Recombinant, Human, aa21-255, His-Trx-tag (CHRNA1)

Catalog Number: USB-405856
Article Name: Acetylcholine Receptor Subunit Alpha, Recombinant, Human, aa21-255, His-Trx-tag (CHRNA1)
Biozol Catalog Number: USB-405856
Supplier Catalog Number: 405856
Alternative Catalog Number: USB-405856-20,USB-405856-100,USB-405856-1
Manufacturer: US Biological
Category: Molekularbiologie
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Partial recombinant protein corresponding to aa21-255 from human Acetylcholine Receptor Subunit Alpha, fused to 6X His-Trx-tag at N-terminal, expressed in E. coli. Swiss/UniProt: P02708 Molecular Weight: ~44.1kD Amino Acid Sequence: SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.1
UniProt: P02708
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol