Acetylcholine Receptor Subunit alpha, Recombinant, Mouse, aa21-230, His-SUMO-Tag (Chrna1)

Catalog Number: USB-405857
Article Name: Acetylcholine Receptor Subunit alpha, Recombinant, Mouse, aa21-230, His-SUMO-Tag (Chrna1)
Biozol Catalog Number: USB-405857
Supplier Catalog Number: 405857
Alternative Catalog Number: USB-405857-20,USB-405857-100
Manufacturer: US Biological
Category: Molekularbiologie
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Source: Partial recombinant protein corresponding to aa21-230 from mouse Acetylcholine receptor subunit alpha, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD Amino Acid Sequence: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.5
UniProt: P04756
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.