Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)

Catalog Number: USB-405887
Article Name: Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)
Biozol Catalog Number: USB-405887
Supplier Catalog Number: 405887
Alternative Catalog Number: USB-405887-20,USB-405887-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. Partial recombinant protein corresponding to aa19-550 from mouse Carboxylesterase 1C, expressed in E. coli. Swiss/UniProt: P23953. Molecular Weight: ~58.6kD Amino Acid Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 58.6
UniProt: P23953
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol