Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1),

Product Overview

• Article Name: Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1),
• Biozol Catalog Number: USB-405888
• Supplier Catalog Number: 405888
• Alternative Catalog Number: USB-405888-20,USB-405888-100,USB-405888-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Carboxypeptidase that catalyzes the release of a C-terminal aa, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Source: Recombinant protein corresponding to aa111-419 from rat carboxypeptidase A1, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~39.6kD Amino Acid Sequence: ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 39.6
• UniProt: P00731
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.