Dedicator of Cytokinesis Protein 8, Recombinant, Human, aa560-729, His-tag (DOCK8)

Catalog Number: USB-405901
Article Name: Dedicator of Cytokinesis Protein 8, Recombinant, Human, aa560-729, His-tag (DOCK8)
Biozol Catalog Number: USB-405901
Supplier Catalog Number: 405901
Alternative Catalog Number: USB-405901-20,USB-405901-100
Manufacturer: US Biological
Category: Molekularbiologie
Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity by controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing. Partial recombinant protein corresponding to aa560-729 from Human Dedicator of Cytokinesis Protein 8, fused to His-tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.3kD Amino Acid Sequence: RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 21.3
UniProt: Q8NF50
Purity: ~85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.