Enterotoxin Type C-2, Recombinant, Staphylococcus aureus, aa28-266 (EntC2)
Biozol Catalog Number:
USB-405917
Supplier Catalog Number:
405917
Alternative Catalog Number:
USB-405917-20,USB-405917-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Recombinant protein corresponding to aa28-266 from Staphylococcus aureus Enterotoxin type C-2, expressed in E. coli. Uniprot/Accession: P34071 Amino Acid Sequence: ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.