Green Fluorescent Protein, Recombinant, Victoria Aequorea, aa1-238, SUMO-Tag (GFP)

Catalog Number: USB-405935
Article Name: Green Fluorescent Protein, Recombinant, Victoria Aequorea, aa1-238, SUMO-Tag (GFP)
Biozol Catalog Number: USB-405935
Supplier Catalog Number: 405935
Alternative Catalog Number: USB-405935-20,USB-405935-100
Manufacturer: US Biological
Category: Molekularbiologie
Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+-activated photoprotein aequorin. Full length recombinant protein corresponding to aa1-238 from Aequorea Victoria Green fluorescent protein, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Accession/Uniprot: P42212 Molecular Weight: ~42.9kD Amino Acid Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 42.9
UniProt: P42212
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris-HCl, pH 8.0, 50% glycerol.