HLA class I Histocompatibility Antigen, alpha Chain G Protein, Recombinant, Human, aa25-338, His-Tag (HLA-G)

Product Overview

• Article Name: HLA class I Histocompatibility Antigen, alpha Chain G Protein, Recombinant, Human, aa25-338, His-Tag (HLA-G)
• Biozol Catalog Number: USB-405947
• Supplier Catalog Number: 405947
• Alternative Catalog Number: USB-405947-20,USB-405947-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells. Source: Recombinant protein corresponding toaa25-338 from human HLA class I histocompatibility antigen, alpha chain G protein, fused to His-Tag at N-terminal, expressed in mammalian cell. Molecular Weight: ~39.6kD Amino Acid Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 39.6
• UniProt: P17693
• Purity: ~90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.