Homeobox Protein Nkx-3.2, Recombinant, Mouse, aa1-333, His-Tag, Myc-Tag (Nkx3-2)
Biozol Catalog Number:
USB-405949
Supplier Catalog Number:
405949
Alternative Catalog Number:
USB-405949-20,USB-405949-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. Plays a role in distal stomach development, required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear, required for tympanic ring and gonium development and in the regulation of the width of the malleus. Source: Recombinant protein corresponding to aa1-333 from human Homeobox protein fused to His-Tag at N terminal and fused to Myc-Tag at C terminal, expressed in E. coli. Molecular Weight: ~40.2kD Amino Acid Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.