Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, His-tag (mpt64)

Catalog Number: USB-405954
Article Name: Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, His-tag (mpt64)
Biozol Catalog Number: USB-405954
Supplier Catalog Number: 405954
Alternative Catalog Number: USB-405954-20,USB-405954-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa24-228 from Mycobacterium tuberculosis Immunogenic protein MPT64, fused to His-tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~24.5kD Amino Acid Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.5
UniProt: P9WIN8
Purity: ~85% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.