Integrin beta-8, Recombinant, Rabbit, aa146-384, His-tag, Myc-tag (ITGB8)

Catalog Number: USB-405958
Article Name: Integrin beta-8, Recombinant, Rabbit, aa146-384, His-tag, Myc-tag (ITGB8)
Biozol Catalog Number: USB-405958
Supplier Catalog Number: 405958
Alternative Catalog Number: USB-405958-20,USB-405958-100
Manufacturer: US Biological
Category: Molekularbiologie
Integrin alpha-V/beta-8 is a receptor for fibronectin. Source: Recombinant protein corresponding to aa146-384 from rabbit Integrin beta-8, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~31.9kD Amino Acid Sequence: PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 31.9
UniProt: P26013
Purity: ~85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.