Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-tag (IL4R)

Catalog Number: USB-405964
Article Name: Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-tag (IL4R)
Biozol Catalog Number: USB-405964
Supplier Catalog Number: 405964
Alternative Catalog Number: USB-405964-20,USB-405964-100
Manufacturer: US Biological
Category: Molekularbiologie
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. Source: Recombinant protein corresponding to aa33-240 from Porcine Interleukin-4 Receptor Subunit Alpha, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.2kD Amino Acid Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.2
UniProt: Q863Z5
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.