Legumin Type B, Recombinant, Vicia Faba, aa1-148, His-tag (LEB6)

Product Overview

• Article Name: Legumin Type B, Recombinant, Vicia Faba, aa1-148, His-tag (LEB6)
• Biozol Catalog Number: USB-405975
• Supplier Catalog Number: 405975
• Alternative Catalog Number: USB-405975-20,USB-405975-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals. Source: Recombinant protein corresponding to aa1-148 from Vicia Faba Legumin Type B, fused to His-tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.0kD Amino Acid Sequence: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 19
• UniProt: P16079
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.