Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa10-104, His-B2M-JD-tag (LY6G6D, Megakaryocyte-enhanced Gene Transcript 1 Protein)

Catalog Number: USB-405978
Article Name: Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa10-104, His-B2M-JD-tag (LY6G6D, Megakaryocyte-enhanced Gene Transcript 1 Protein)
Biozol Catalog Number: USB-405978
Supplier Catalog Number: 405978
Alternative Catalog Number: USB-405978-20,USB-405978-100,USB-405978-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Partial recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD Amino Acid Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.5
UniProt: O95868
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.