OmpA Family Protein, Recombinant, Salmonella Enterica, aa82-220, His-Tag, Myc-Tag (A673_03341)

Product Overview

• Article Name: OmpA Family Protein, Recombinant, Salmonella Enterica, aa82-220, His-Tag, Myc-Tag (A673_03341)
• Biozol Catalog Number: USB-406007
• Supplier Catalog Number: 406007
• Alternative Catalog Number: USB-406007-20,USB-406007-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Partial recombinant protein corresponding to aa82-220 from Salmonella enterica OmpA family protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~18.6kD Amino Acid Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 18.6
• UniProt: S4JJH7
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.