Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-SUMO-Tag, Myc-Tag (OXT)

Catalog Number: USB-406012
Article Name: Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-SUMO-Tag, Myc-Tag (OXT)
Biozol Catalog Number: USB-406012
Supplier Catalog Number: 406012
Alternative Catalog Number: USB-406012-20,USB-406012-100,USB-406012-1
Manufacturer: US Biological
Category: Molekularbiologie
Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Source: Recombinant protein corresponding to aa32-125 from human Oxytocin-neurophysin 1, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~29.6kD AA Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.6
UniProt: P01178
Purity: ~90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.