Polyadenylate-binding Protein RBP47A, Recombinant, Arabidopsis Thaliana, aa1-445, His-tag, Myc-tag (RBP47A)

Product Overview

• Article Name: Polyadenylate-binding Protein RBP47A, Recombinant, Arabidopsis Thaliana, aa1-445, His-tag, Myc-tag (RBP47A)
• Biozol Catalog Number: USB-406021
• Supplier Catalog Number: 406021
• Alternative Catalog Number: USB-406021-20,USB-406021-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation. Source: Recombinant protein corresponding to aa1-445 from Arabidopsis Thaliana, Polyadenylate-binding Protein RBP47A, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expresed in E. coli. Molecular Weight: ~53.5kD Amino Acid Sequence: MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSPNKQWRSDSGNQWNGGYSRGQGYNNGYANQDSNMYATAAAAVPGAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 53.5
• UniProt: F4I3B3
• Purity: ~90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.