Protein corresponding to aa1-352 from full length human ZFP1.
Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MERDHRNPDEQARQFLILKNQTPIEERGDLFGKALNL NTDFVSLRQVPYKYDLYEKTLKYNSDLLNSNRSYAGK QTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALS HKAAIFKHQKIKNLVQPFICTYCDKAFSFKSLLISHKRIH TGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPFECPE CGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKF ELTTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHTG EKRYECSECGKSFIQNSQLIIHMRTHTGEKPYECTECG KTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLS VHQRVHIGEKP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
