PRKAA1 (5-AMP-Activated Protein Kinase Catalytic Subunit Alpha-1, Protein Kinase, AMP-Activated, Alpha 1 Catalytic Subunit), Rabbit
Catalog Number:
USB-489356
- Images (0)
| Article Name: | PRKAA1 (5-AMP-Activated Protein Kinase Catalytic Subunit Alpha-1, Protein Kinase, AMP-Activated, Alpha 1 Catalytic Subunit), Rabbit |
| Biozol Catalog Number: | USB-489356 |
| Supplier Catalog Number: | 489356 |
| Alternative Catalog Number: | USB-489356-100 |
| Manufacturer: | US Biological |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Immunogen: | Synthetic peptide located within the following region: SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID from the middle region of human PRKAA1. |
| PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1,1000-1,4000 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Product Guarantee and Expert Support
