Beta-2-Microglobulin, Recombinant, Sheep, aa21-118, His-Tag, Myc-Tag (B2M)

Catalog Number: USB-517820
Article Name: Beta-2-Microglobulin, Recombinant, Sheep, aa21-118, His-Tag, Myc-Tag (B2M)
Biozol Catalog Number: USB-517820
Supplier Catalog Number: 517820
Alternative Catalog Number: USB-517820-20,USB-517820-200
Manufacturer: US Biological
Category: Molekularbiologie
Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Source: Recombinant protein corresponding to aa21-118 of sheep Beta-2-Microglobulin, fused to 10xHis-Tag and C-terminal Myc-Tag, expressed in E. coli. Molecular Weight: ~18.6kD Amino Acid Sequence: IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.6
UniProt: Q6QAT4
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.