Beta-Lactamase CTX-M-1, Recombinant, E. coli, aa29-291, His-Tag (bla)
Biozol Catalog Number:
USB-517823
Supplier Catalog Number:
517823
Alternative Catalog Number:
USB-517823-20,USB-517823-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins. Source: Recombinant protein corresponding to aa29-291 of E. coli Beta-Lactamase CTX-M-1, fused to 6xHis-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~30.2kD Amino Acid Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted