Blood Group Rh (D) Polypeptide, Recombinant, Human, aa388-417, His-GST-Tag (RHD)
Biozol Catalog Number:
USB-517824
Supplier Catalog Number:
517824
Alternative Catalog Number:
USB-517824-20,USB-517824-100
Manufacturer:
US Biological
Category:
Molekularbiologie
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. Partial recombinant protein corresponding to aa388-417 of human Blood Group Rh (D) Polypeptide, fused to 6xHis-GST-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: Q02161 Molecular Weight: ~33.6kD Amino Acid Sequence: LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted