Bone Morphogenetic Protein 3, Recombinant, Human, aa363-472, Myc-Tag (BMP3)

Product Overview

• Article Name: Bone Morphogenetic Protein 3, Recombinant, Human, aa363-472, Myc-Tag (BMP3)
• Biozol Catalog Number: USB-517827
• Supplier Catalog Number: 517827
• Alternative Catalog Number: USB-517827-20,USB-517827-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Source: Recombinant protein corresponding to aa363-472 of human Bone Morphogenetic Protein 3, fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~13.9kD Amino Acid Sequence: QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 13.9
• UniProt: P12645
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.