Bone Morphogenetic Protein 3, Recombinant, Mouse, aa359-468, His-Tag (Bmp3)

Product Overview

• Article Name: Bone Morphogenetic Protein 3, Recombinant, Mouse, aa359-468, His-Tag (Bmp3)
• Biozol Catalog Number: USB-517828
• Supplier Catalog Number: 517828
• Alternative Catalog Number: USB-517828-20,USB-517828-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Source: Recombinant protein corresponding to aa359-468 of mouse Bone Morphogenetic Protein 3, fused to 6xHis-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~14.4kD Amino Acid Sequence: QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 14.4
• UniProt: Q8BHE5
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.