Cathepsin O, Recombinant, Human, aa108-321, MBP-Tag, His-Tag (CTSO)

Catalog Number: USB-517839
Article Name: Cathepsin O, Recombinant, Human, aa108-321, MBP-Tag, His-Tag (CTSO)
Biozol Catalog Number: USB-517839
Supplier Catalog Number: 517839
Alternative Catalog Number: USB-517839-20,USB-517839-100
Manufacturer: US Biological
Category: Molekularbiologie
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Source: Recombinant protein corresponding to aa108-321 of human Cathepsin O, fused to MBP-Tag at N-terminal and 6xHis-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~67.5kD Amino Acid Sequence: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 67.5
UniProt: P43234
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.