Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)

Catalog Number: USB-517855
Article Name: Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)
Biozol Catalog Number: USB-517855
Supplier Catalog Number: 517855
Alternative Catalog Number: USB-517855-20,USB-517855-200
Manufacturer: US Biological
Category: Molekularbiologie
Mannose-binding lectin. Source: Full length recombinant protein corresponding to aa1-111 of Neurospora Crassa Cyanovirin-N Homolog, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accession: Q7S6U4 Molecular Weight: ~16.9kD AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.9
UniProt: Q7S6U4
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.