Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128)

Catalog Number: USB-517862
Article Name: Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128)
Biozol Catalog Number: USB-517862
Supplier Catalog Number: 517862
Alternative Catalog Number: USB-517862-20,USB-517862-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant full length protein corresponding to aa1-171 of human Cytomegalovirus Uncharacterized Protein UL128, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.7kD Amino Acid Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.7
UniProt: P16837
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.