Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)

Product Overview

• Article Name: Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)
• Biozol Catalog Number: USB-517868
• Supplier Catalog Number: 517868
• Alternative Catalog Number: USB-517868-20,USB-517868-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP (By similarity). Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing. Source: Partial recombinant protein corresponding to aa561-730 of mouse Dedicator of Cytokinesis Protein 8, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.7kD Amino Acid Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 24.7
• UniProt: Q8C147
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.