DNA-Directed RNA Polymerases I, II, and III Subunit RPABC1, Recombinant, Kluyveromyces Marxianus, aa1-215, His-Tag (RPB5)

Product Overview

• Article Name: DNA-Directed RNA Polymerases I, II, and III Subunit RPABC1, Recombinant, Kluyveromyces Marxianus, aa1-215, His-Tag (RPB5)
• Biozol Catalog Number: USB-517879
• Supplier Catalog Number: 517879
• Alternative Catalog Number: USB-517879-20,USB-517879-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process. Source: Recombinant full length protein corresponding to aa1-215 of Kluyveromyces Marxianus DNA-Directed RNA Polymerases I, II, and III Subunit RPABC1, fused to 6xHis-Tag, expressed in E. coli. Molecular Weight: ~26.6kD Amino Acid Sequence: MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 29
• UniProt: Q9P4B9
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.