Endothelin-Converting Enzyme-Like 1, Recombinant, Mouse, aa1-61, His-Tag, Myc-Tag (Ecel1)

Catalog Number: USB-517890
Article Name: Endothelin-Converting Enzyme-Like 1, Recombinant, Mouse, aa1-61, His-Tag, Myc-Tag (Ecel1)
Biozol Catalog Number: USB-517890
Supplier Catalog Number: 517890
Alternative Catalog Number: USB-517890-20,USB-517890-100
Manufacturer: US Biological
Category: Molekularbiologie
May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. Source: Recombinant protein corresponding to aa1-61 of mouse Endothelin-Converting Enzyme-Like 1, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~13.7kD Amino Acid Sequence: MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.7
UniProt: Q9JMI0
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.