Enterotoxin Type A, Recombinant, Staphylococcus Aureus, aa25-257, His-Tag (entA)

Product Overview

• Article Name: Enterotoxin Type A, Recombinant, Staphylococcus Aureus, aa25-257, His-Tag (entA)
• Biozol Catalog Number: USB-517892
• Supplier Catalog Number: 517892
• Alternative Catalog Number: USB-517892-20,USB-517892-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa25-257 of Staphylococcus Aureus Enterotoxin Type A, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.1kD Amino Acid Sequence: SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 31.1
• UniProt: P0A0L2
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.