Gamma-Crystallin B, Recombinant, Rat, aa2-175, His-Tag (Crygb)

Product Overview

• Article Name: Gamma-Crystallin B, Recombinant, Rat, aa2-175, His-Tag (Crygb)
• Biozol Catalog Number: USB-517918
• Supplier Catalog Number: 517918
• Alternative Catalog Number: USB-517918-20,USB-517918-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Crystallins are the dominant structural components of the vertebra. Recombinant protein corresponding to aa2-175 of rat Gamma-Crystallin B, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~23kD Amino Acid Sequence: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 23
• UniProt: P10066
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.