HEAT Repeat-Containing Protein 6, Recombinant, Human, aa1052-1175, His-Tag, Myc-Tag (HEATR6)

Catalog Number: USB-517945
Article Name: HEAT Repeat-Containing Protein 6, Recombinant, Human, aa1052-1175, His-Tag, Myc-Tag (HEATR6)
Biozol Catalog Number: USB-517945
Supplier Catalog Number: 517945
Alternative Catalog Number: USB-517945-20,USB-517945-200
Manufacturer: US Biological
Category: Molekularbiologie
Amplification-dependent oncogene. Source: Partial recombinant protein corresponding to aa1052-1175 of human HEAT Repeat-Containing Protein 6, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~18.5kD Amino Acid Sequence: KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.5
UniProt: Q6AI08
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.