Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-Tag, Myc-Tag (eltA)

Product Overview

• Article Name: Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-Tag, Myc-Tag (eltA)
• Biozol Catalog Number: USB-517946
• Supplier Catalog Number: 517946
• Alternative Catalog Number: USB-517946-20,USB-517946-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. Source: Recombinant protein corresponding to aa19-258 of E. coli Heat-labile Enterotoxin A Chain, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~32.8kD Amino Acid Sequence: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 32.8
• UniProt: P06717
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.