Homogentisate 1,2-Dioxygenase, Recombinant, Human, aa1-445, His-Tag (HGD)

Catalog Number: USB-517957
Article Name: Homogentisate 1,2-Dioxygenase, Recombinant, Human, aa1-445, His-Tag (HGD)
Biozol Catalog Number: USB-517957
Supplier Catalog Number: 517957
Alternative Catalog Number: USB-517957-20,USB-517957-100
Manufacturer: US Biological
Category: Molekularbiologie
Full length recombinant protein corresponding to aa1-445 from human Homogentisate 1,2-Dioxygenase, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: Q93099 Molecular Weight: ~54kD Amino Acid Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 54
UniProt: Q93099
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.