Hyaluronan and Proteoglycan Link Protein 1, Recombinant, Human, aa16-354, His-Tag (HAPLN1)

Product Overview

• Article Name: Hyaluronan and Proteoglycan Link Protein 1, Recombinant, Human, aa16-354, His-Tag (HAPLN1)
• Biozol Catalog Number: USB-517958
• Supplier Catalog Number: 517958
• Alternative Catalog Number: USB-517958-20,USB-517958-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix. Source: Recombinant protein corresponding to aa16-354 of human Hyaluronan and Proteoglycan Link Protein 1, fused to 10xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44kD Amino Acid Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 44
• UniProt: P10915
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.