Inter-Alpha-Trypsin Inhibitor Heavy Chain H4, Recombinant, Human, aa689-930, His-Sumo-Tag (ITIH4)
Biozol Catalog Number:
USB-517966
Supplier Catalog Number:
517966
Alternative Catalog Number:
USB-517966-20,USB-517966-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration. Source: Recombinant protein corresponding to aa689-930 of human Inter-Alpha-Trypsin Inhibitor Heavy Chain H4, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.9kD Amino Acid Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted