Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B, aa20-331, His-Tag (porB)

Catalog Number: USB-517996
Article Name: Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B, aa20-331, His-Tag (porB)
Biozol Catalog Number: USB-517996
Supplier Catalog Number: 517996
Alternative Catalog Number: USB-517996-20,USB-517996-200
Manufacturer: US Biological
Category: Molekularbiologie
Serves as a slightly cation selective porin. Source: Recombinant protein corresponding to aa20-331 of Neisseria Meningitidis Serogroup B Major Outer Membrane Protein P.IB, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.8kD Amino Acid Sequence: DVTLYGTIKAGVETSRSVAHNGAQAASVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQENVNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLVEENYSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGSFDATNYNNDYDQVVVGAEYDFSKRTSALVSAGWLQEGKGESKFVSTAGGVGLRHKF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.8
UniProt: P30687
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.