Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B, aa20-331, His-Tag (porB)

Product Overview

• Article Name: Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B, aa20-331, His-Tag (porB)
• Biozol Catalog Number: USB-517997
• Supplier Catalog Number: 517997
• Alternative Catalog Number: USB-517997-20,USB-517997-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Serves as a slightly cation selective porin. Source: Recombinant protein corresponding to aa20-331 of Neisseria Meningitidis Serogroup B Major Outer Membrane Protein P.IB, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.9kD Amino Acid Sequence: DVTLYGTIKAGVETSRSVAHNGAQAASVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHRVQEDINIEKYQIHRLVSGYDNDALHASVAVQQQDAKLVEENYSHNSQTEVAATLAYRFGNVTPRVSYAHGFRGLVDSADYTNDYDQVVVGAEYDFSKRTSALVSAGWLQEGKGKNKFVSTAGGVGLRHKF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 37.9
• UniProt: P30689
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.